티스토리

rudgh99

검색하기

블로그 홈

rudgh99

algorithmjjangdol.tistory.com/m

컴퓨터와 친해지고 싶은 사람의 잡다한 기록

구독자: 1

방명록 방문하기

주요 글 목록

[Akkermansia muciniphila] Transcriptomics and metabolomics reveal the adaption of Akkermansia muciniphila to high mucin by regulating energy homeostasis 논문 데이터 분석(1) ※ Transcriptomics and metabolomics reveal the adaption of Akkermansia muciniphila to high mucin by regulating energy homeostasis 논문에서 쓰인 transcriptomics data를 직접 다운로드하여 분석하는 프로젝트를 진행하려 한다. 0. Reference Genome, Transcriptomics data 찾기 이 paper에서 "RNA isolation and analysis" 페이지에 Ref genome과 Transcriptomics data의 accession number를 제공해주고 있다. 정보를 정리해 보자면 다음과 같다. Raw sequencing data (transcriptomics .. 공감수 5 댓글수 0 2024. 11. 22.
[Docker] 1. 이미지 빌드하고 container에서 실행하기 1년 전부터 oracle vm을 써왔다. 하지만, 그래픽이 깨지는 현상, 너무 무겁다는 점, edit이 불편하다는 점 그리고 알 수 없는 오류가 지속적으로 발생한다는 점 때문에 지우고 설치하기를 반복했다. 이점 때문에 Docker를 배우기로 마음먹었다. Docker의 가장 강력한 점이라고 한다면 어디서든 코드가 돌아가도록 하는 것이라고 생각한다. 프로그램을 만들고 그것을 배포할 때 에러가 나는 경우가 많은데, docker는 이런 부분을 잡아준다. 0. 프로젝트 시작 : Ubuntu에서 python code를 실행시켜 보는 코드를 만들고 , 실행시켜 보자. 1. image 만들기 image라는 것은 밀키트와 같다. 내가 프로그램을 실행시키기 위해서 필요한 모든 것들을 담아낸 것이 image다. 따라서.. 공감수 6 댓글수 1 2024. 11. 20.
[Docker] 로그인 오류 Docker를 실행하고 로그인을 할 때 오류가 발생했다. 이때는 기존의 계정이 존재해서, 오류가 발생했는지 몰랐다. 이때는 자신이 사용하는 브라우저를 바꿔서, docker hub로 들어가 로그인을 다시 해보면 된다. 제대로 login 되었는지 확인하기 위해 아래와 같은 코드를 쳐보자. docker logoutdocker login 공감수 4 댓글수 0 2024. 11. 20.
[Bioinformatics] pipeline tool installation 1. BWA2 ( reference seq에 mapping)curl -L https://github.com/bwa-mem2/bwa-mem2/releases/download/v2.0pre2/bwa-mem2-2.0pre2_x64-linux.tar.bz2 | tar jxf -cd bwa-mem2-2.0pre2_x64-linux./bwa-mem2위 코드를 차례대로 실행시키면 된다. 2. GATK4 (variant calling)wget https://github.com/broadinstitute/gatk/releases/download/4.2.0.0/gatk-4.2.0.0.zipunzip gatk-4.2.0.0.zip위 코드를 실행시켜 설치를 진행한다. 이후, 설치가 제대로 되었는지 확인하기 위해서 아래 코.. 공감수 33 댓글수 19 2024. 11. 17.
[Ferritin] Ferritin Lactiplantibacillus plantarum 분석 1. Lactiplantibacillus plantarum에서 발현되는 ferritin 데이터 생성. ncbi protein 사이트에 접속해서 "Ferritin Lactiplantibacillus plantarum" 입력했다. 총 43개의 searching result가 나왔고, 이 파일들을 다 모아서 ferritinL.plantarum.raw.fasta 파일을 만들었다. >ALO75854.1 ferritin (plasmid) [Lactiplantibacillus plantarum]MKYTKTKAVLNQLVADLSQMSMIIHQTHWYMRGPNFLKLHPLMDEFMEEIDSQLDVISERLIALDGSPYSTLKEMAENTKIQDWPGEWDKTTPERLAHLVDGYRYLEDLYQHGIEVSDVEKDFST.. 공감수 3 댓글수 0 2024. 11. 16.
[Coronavirus] envelope protein [Severe acute respiratory syndrome-related coronavirus] 분석 1. 사이트 : https://www.ncbi.nlm.nih.gov/protein/XBR17120.1?report=fasta envelope protein [Severe acute respiratory syndrome-related coronaviru - Protein - NCBIno features Feature First Previous Next Last Detailswww.ncbi.nlm.nih.gov2. linux 환경으로 파일을 전송하기 wget "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=protein&id=XBR17120.1&rettype=fasta&retmode=text" -O coronaEnv.raw.fasta efectc.. 공감수 3 댓글수 1 2024. 11. 16.
[Oracle VM] anaconda 설치하기 1. ubuntu에 anaconda 설치하기 https://www.anaconda.com/download/success Download Now | AnacondaAnaconda is the birthplace of Python data science. We are a movement of data scientists, data-driven enterprises, and open source communities.www.anaconda.com위 홈페이지에 들어가 , 자신의 os에 맞는 버전을 우클릭 후 링크 주소 복사한다. 이후, 아래 코드를 실행한다. wget https://repo.anaconda.com/archive/Anaconda3-2024.10-1-Linux-x86_64.sh 2. 다운로드하여진 .. 공감수 2 댓글수 1 2024. 11. 16.
[Oracle VM] 단축키 정리 1. 글씨 키우기 ctrl + shift + +/= 2. 글씨 축소하기 ctrl + - 3. 폰트는 terminal에서 preferences로 들어가 바꾸기 ( 형광색 이용하면 잘 보임) 4. 공유폴더 설정 local pc의 data를 가상환경에 설치되어 있는 ubuntu와 공유하기 위해서는 공유폴더를 설정하는 것이 좋은 대안이다. 따라서 , 공유폴더를 설정해 보자. 저기서 플러스 버튼을 눌러서 , 자동 마운트와 항상 사용을 클릭한 뒤, 공유폴더가 마운트 되길 원하는 경로와 공유폴더가 현재 위치해 있는 경로를 입력해 주면 된다. 이후, 공유폴더에 접속하려 할 때 permission denied 가 뜬다면 다음과 같은 코드를 입력해 보자. 나의 경우, ls -ld share를 실행했을 때 root v.. 공감수 2 댓글수 0 2024. 11. 16.
[Orcle VM] Ubuntu copy and paste 1. 관리자 페이지에 들어가 클립보드 설정 조작 클립보드 공유와 드래그 앤 드롭 양방향 설정 2. vm에 접속해서 장치 --> guest cd 이미지 삽입 그러면 왼쪽에 cd가 생길 것이다. cd클릭하기 전에 터미널에서 아래 코드 실행 sudo apt updatesudo apt upgrade 완료되면, cd 클릭하고 파일 빈 부분 우측 마우스 클릭 후 터미널 오픈 후, 아래코드 실행 sudo apt install bzip2sudo ./VBoxLinuxAdditions.run 자료출처 : https://dschloe.github.io/settings/2024/05/oracle_vm_box_ubuntu_bidirect_copy/ Oracle VM Box 양방향 복사 붙이기개요 VirtualBox를 통해 복.. 공감수 1 댓글수 0 2024. 11. 16.
[BOJ] 10816번 : 숫자 카드 2 1. problem : https://www.acmicpc.net/problem/10816 2. solution 1 : #include using namespace std;int n, m; vector v1; vector v2; vector ans; int lower_search_func(int& a) { int left = 0, right = n; while (left = a) right = mid; else left = mid + 1; } return left; }int upper_search_func(int& a) { int left = 0, right = n; while (left > n; for (int i = 0; i > x; v1.push_back(x); } cin >> m; f.. 공감수 1 댓글수 1 2024. 11. 13.
[B.plantarii] mutant vs wild type 0. wild type과 mutant의 전사체 데이터를 비교해 보는 프로젝트를 진행하였다. 따라서, 필요한 데이터는 각 type의 전사체 데이터, annotation 파일 그리고 참조유전체 파일이다. 1. fastq 파일을 bam 파일로 바꾸자. fastq는 header 부분과 quality score 가 들어있는 파일이다. 이제 이 파일을 bam 파일로 바꿔야 된다. 그러기 위해서는 필요한 툴들부터 설치해 보자. (참고로, 이 프로젝트는 구글 코랩에서 진행하였다.) # hisat2와 samtools 설치!apt-get update!apt-get install -y hisat2 samtools위 코드를 실행하고 난 후, # 참조 유전체 경로 설정reference_path = '/content/drive.. 공감수 2 댓글수 3 2024. 11. 13.
[VM] Guest CD 설치 복사 붙여 넣기가 되지 않아, 찾아보니 guest cd를 삽입해야 한다고 한다. 따라서, 기존에 있는 cd를 vm 앱에서 꺼낸다음, vm을 run 한다. 이후, guest cd 설치를 진행한다. 출처 : https://velog.io/@dksek3050/Ubuntu-%EC%9A%B0%EB%B6%84%ED%88%AC-%EC%9C%88%EB%8F%84%EC%9A%B0-%ED%81%B4%EB%A6%BD%EB%B3%B4%EB%93%9C-%EA%B3%B5%EC%9C%A0-%EC%95%88%EB%90%A8-%EB%AC%B8%EC%A0%9C-VirtualBox-%EA%B0%80%EC%83%81-%EA%B4%91-%EB%94%94%EC%8A%A4%ED%81%AC-%EC%82%BD%EC%9E%85-%EB%AC%B8%E.. 공감수 1 댓글수 0 2024. 11. 8.
[Project1] Binary_classification_of_E.coli 0. 서론 사진을 input으로 넣었을 때, E.coli 사진인지 구분하는 binary_classification model을 만들어보려 한다. 따라서, 준비해야하는 것은 E.coli 사진과 E.coli가 아닌 사진이 필요하다. 내가 이번에 모은 사진은 E.coli 50장 , non_E.coli 50장이다. 모으는 방법은 google image에서 수작업으로 진행했다. 다음번 프로젝트에서는 웹 크롤링을 이용해서 모아보려 한다. 모은 사진은 아래와 같이 폴더 구조를 만들자. dataset/ ├── E_coli/ │ ├── image1.jpg │ ├── image2.jpg │ └── ... └── Non_E_coli/ ├── image1.jpg ├── image2.jpg └.. 공감수 2 댓글수 0 2024. 10. 31.
[BOJ] 1920번 : 수 찾기 1. problem : https://www.acmicpc.net/problem/1920 2. solution 1 :#include using namespace std;int N, M; vector v1; vector v2; bool find_num(int& a) { int left = 0; int right = N-1; while (left > N; for (int i = 0; i > x; v1.push_back(x); } sort(v1.begin(), v1.end()); cin >> M; for (int i = 0; i > x; v2.push_back(x); } for (int i = 0; i binary search를 이용해 답을 도출했다. binary search를 하기 위해서는 .. 공감수 0 댓글수 1 2024. 10. 31.
[BOJ] 1038번 : 감소하는 수 1. problem : https://www.acmicpc.net/problem/1038 2. solution 1 :#include using namespace std;vector v(10, 0);int main(void) { ios::sync_with_stdio(0); cin.tie(0); int n; cin >> n; int cnt = 0; for (int i = 1; i source code 출처 : https://github.com/encrypted-def/basic-algo-lecture/blob/master/0x12/solutions/1038.cpp basic-algo-lecture/0x12/solutions/1038.cpp at master · encrypted-def/basic-algo.. 공감수 1 댓글수 2 2024. 10. 11.
[BOJ] 1011번 : Fly me to the Alpha Centauri 1. problem : https://www.acmicpc.net/problem/1011 2. solution 1 :#include using namespace std;long long func(long long a) { return (2 * sqrt(a) - 1e-9);}int main(void) { ios::sync_with_stdio(0); cin.tie(0); int t; long long x, y; cin >> t; while (t--) { cin >> x >> y; cout source code 출처 : https://github.com/encrypted-def/basic-algo-lecture/blob/master/0x12/solutions/1011.cpp basic-algo-lec.. 공감수 0 댓글수 1 2024. 10. 10.
[BOJ] 2482번 : 색상환 1. problem : https://www.acmicpc.net/problem/2482 2. solution 1 :#include using namespace std;int n, k; const int val = 1004;const int mod = 1e9 + 3;int d[val][val]; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> n >> k; if (k == 1) { cout source code 참고 : https://akim9905.tistory.com/71 [백준] 2482번 색상환[적용한 알고리즘] DP [아이디어] 1번과 N번이 둘 다 색칠되는 경우를 제외하고는, 나머지 경우는 선형으로 생각해줘도 된다. dp[N].. 공감수 0 댓글수 0 2024. 10. 8.
[BOJ] 11660번 : 구간 합 구하기 5 1. problem : https://www.acmicpc.net/problem/11660 2. solution 1 :#include using namespace std;const int val = 1030; int board[val][val];int d[val][val];int main(void) { ios::sync_with_stdio(0); cin.tie(0); int n, m; cin >> n >> m; for (int i = 1; i > board[i][j]; } for (int i = 1; i > x1 >> y1 >> x2 >> y2; int ans = d[x2][y2] - d[x2][y1 - 1] - d[x1 - 1][y2] + d[x1 - 1][y1 - 1]; cout dp를.. 공감수 0 댓글수 0 2024. 10. 7.
[BOJ] 9657번 : 돌 게임 3 1. problem : https://www.acmicpc.net/problem/9657 2. solution 1 :#include using namespace std;vector winners = { "SK","CY" };int n; vector rocks = { 1,3,4 }; int d[1005]; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> n; d[1] = 0, d[2] = 1, d[3] = 0, d[4] = 0; for (int i = 5; i source code 출처 : https://github.com/encrypted-def/basic-algo-lecture/blob/master/0x10/solutions/9657.c.. 공감수 2 댓글수 1 2024. 10. 6.
[BOJ] 1520번 : 내리막 길 1. problem : https://www.acmicpc.net/problem/1520 2. solution 1 :#include using namespace std;int dx[4] = { 0,1,0,-1 };int dy[4] = { 1,0,-1,0 }; int n, m; int a[505][505], d[505][505]; int dp(int x, int y) { if (d[x][y] != -1) return d[x][y]; if (x == n - 1 && y == m - 1) return 1; int& ret = d[x][y]; ret = 0; for (int dir = 0; dir = n || ny = m) continue; if (a[x][y] > a[nx][ny]) ret += dp(.. 공감수 1 댓글수 0 2024. 10. 5.
[BOJ] 1476번 : 날짜 계산 1. problem : https://www.acmicpc.net/problem/1476 2. solution 1:#include using namespace std;int e, s, m; int gcd(int a, int b) { if (b == 0) return a; return gcd(b, a % b);}int lcm(int a, int b) { return a / gcd(a, b) * b;}int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> e >> s >> m; e--, s--, m--; int i = e; while (i % 28 != s) i += 15; int l = lcm(15, 28); while (i % 19 != m.. 공감수 0 댓글수 0 2024. 10. 4.
[BOJ] 2133번: 타일 채우기 1. problem : https://www.acmicpc.net/problem/2133 2. solution 1 :#include using namespace std;int d[33];int main(void) { ios::sync_with_stdio(0); cin.tie(0); int n; cin >> n; d[0] = 1, d[2] = 3; for (int i = 3; i = 0; j -= 2) { d[i] += d[j] * 2; } } cout source code 출처 : https://github.com/encrypted-def/basic-algo-lecture/blob/master/0x10/solutions/2133.cpp basic-algo-lecture/0x10/solutions.. 공감수 0 댓글수 0 2024. 10. 3.
[BOJ] 9613번 : GCD 합 1. problem : https://www.acmicpc.net/problem/9613 2. solution 1 :#include using namespace std;int gcd(int a, int b) { if (b == 0) return a; return gcd(b, a % b);}int main(void) { ios::sync_with_stdio(0); cin.tie(0); int t; cin >> t; while (t--) { int n; cin >> n; long long ans = 0; int a[105]; for (int i = 0; i > a[i]; for (int i = 0; i gcd를 직접 구현하여, 문제를 풀었다. ans는 100억이 될 수 있기 때문에, l.. 공감수 0 댓글수 0 2024. 10. 3.
[BOJ] 2294번 : 동전 2 1. problem : https://www.acmicpc.net/problem/2294 2. solution 1 :#include using namespace std;const int val = 10005;int coins[val]; int d[val];int main(void) { ios::sync_with_stdio(0); cin.tie(0); int n, k; cin >> n >> k; for (int i = 1; i > coins[i]; d[0] = 0; for (int i = 1; i i) continue; if (d[i-coins[c]] == 10001) continue; d[i] = min(d[i], d[i - coins[c]] + 1); } } if (d[k] == 1.. 공감수 0 댓글수 0 2024. 10. 3.
[BOJ] 1676번 : 팩토리얼 0의 개수 1. problem : https://www.acmicpc.net/problem/1676 2. solution 1 :#include using namespace std;int n; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> n; int cnt = 0; for (int i = 5; i 0이 생기기 위해서는 10이 곱해져야 한다. 10은 2 * 5로, 2와 5의 배수를 찾으면 된다. 하지만, 2의 배수보다 5의 배수가 적기 때문에, 5의 배수의 개수를 세면 된다. 이때, 5의 제곱수는 5의 개수가 제곱승만큼 존재하게 된다. 예를 들어, 5^2은 5가 2개 존재한다. 따라서, 5의 배수, 25의 배수 그리고 125의 배수를 차례차례 더해줘야 .. 공감수 0 댓글수 0 2024. 10. 2.
[BOJ] 4883번 : 삼각 그래프 1. problem : https://www.acmicpc.net/problem/4883 2. solution 1 :#include using namespace std;const int val = 100005;int d[val][4]; int a[val][4];int main(void) { ios::sync_with_stdio(0); cin.tie(0); int t = 0; while (true) { t++; int n; cin >> n; if (n == 0) return 0; for (int i = 1; i > a[i][j]; } d[1][1] = INT_MAX; d[1][2] = a[1][2]; d[1][3] = a[1][2] + a[1][3]; for (int i = 2;.. 공감수 0 댓글수 0 2024. 10. 2.
[BOJ] 4948번 : 베르트랑 공준 1. problem : https://www.acmicpc.net/problem/4948 2. solution 1:#include using namespace std;const int val = 123456 * 2;vector eratos(int a) { vector primes; vector nums(a + 1, true); nums[1] = false; for (int i = 2; i * i primes = eratos(val); while (true) { int n; cin >> n; if (n == 0) return 0; int cnt = 0; for (auto p : primes) { if (n 에라토스테네스의 체를 이용해 풀었다. 공식이 기억나지 않아, 저번에 작성했던.. 공감수 0 댓글수 0 2024. 10. 1.
[BOJ] 1788번 : 피보나치 수의 확장 1. problem : https://www.acmicpc.net/problem/1788 2. solution 1 :#include using namespace std;int n;const int mod = 1000000000;const int val = 1000005;int d[val]; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> n; d[1] = 1; for (int i = 2; i dp를 이용해 풀었다. 따라서, 세 가지 스텝을 따른다. 1. 테이블을 정의한다. d[i] = i번째 피보나치 수 2. 점화식을 작성한다. d[i] = d [i-1] + d [i-2] 3. 초기값을 설정한다. d[0] = 0, d [1] = 1n이 음.. 공감수 0 댓글수 1 2024. 10. 1.
[BOJ] 1193번 : 분수찾기 1. problem : https://www.acmicpc.net/problem/1193 2. solution 1 :#include using namespace std;int x; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> x; int n = 0; while ((n * (n + 1) / 2) 1~n까지의 자연수합으로 n을 결정한 다음, 규칙을 이용해서 diff를 더하거나 빼줬다. 3. solution 2 :// Authored by : SciEm// Co-authored by : -// http://boj.kr/4786afbccbb148098938f248823abd35#include using namespace std;int main() .. 공감수 0 댓글수 0 2024. 10. 1.
[BOJ] 1904번 : 01타일 1. problem : https://www.acmicpc.net/problem/1904 2. solution 1:#include using namespace std;const int mod = 15746; int n; int d[1000005]; int main(void) { ios::sync_with_stdio(0); cin.tie(0); cin >> n; d[1] = 1, d[2] = 2; for (int i = 3; i dp를 이용해 풀었다. 따라서, 세가지 스텝을 따른다. 1. 테이블을 정의한다. d[i] = i자리를 만드는데 필요한 경우의 수2. 점화식을 작성한다. d[i] = d[i-1] + d[i-2] 3. 초기값을 설정한다. d[1] = 1, d[2] = 2 공감수 0 댓글수 0 2024. 10. 1.

문의안내

티스토리
로그인
고객센터

티스토리는 카카오에서 사랑을 담아 만듭니다.