※ Transcriptomics and metabolomics reveal the adaption of Akkermansia muciniphila to high mucin by regulating energy homeostasis 논문에서 쓰인 transcriptomics data를 직접 다운로드하여 분석하는 프로젝트를 진행하려 한다.  0. Reference Genome, Transcriptomics data 찾기 이 paper에서 "RNA isolation and analysis" 페이지에 Ref genome과 Transcriptomics data의 accession number를 제공해주고 있다. 정보를 정리해 보자면 다음과 같다. Raw sequencing data (transcriptomics ..

1. Lactiplantibacillus plantarum에서 발현되는 ferritin  데이터 생성. ncbi protein 사이트에 접속해서 "Ferritin Lactiplantibacillus plantarum" 입력했다. 총 43개의 searching result가 나왔고, 이 파일들을 다 모아서 ferritinL.plantarum.raw.fasta 파일을 만들었다. >ALO75854.1 ferritin (plasmid) [Lactiplantibacillus plantarum]MKYTKTKAVLNQLVADLSQMSMIIHQTHWYMRGPNFLKLHPLMDEFMEEIDSQLDVISERLIALDGSPYSTLKEMAENTKIQDWPGEWDKTTPERLAHLVDGYRYLEDLYQHGIEVSDVEKDFST..

1. 사이트 : https://www.ncbi.nlm.nih.gov/protein/XBR17120.1?report=fasta envelope protein [Severe acute respiratory syndrome-related coronaviru - Protein - NCBIno features Feature First Previous Next Last Detailswww.ncbi.nlm.nih.gov2. linux 환경으로 파일을 전송하기 wget "https://eutils.ncbi.nlm.nih.gov/entrez/eutils/efetch.fcgi?db=protein&id=XBR17120.1&rettype=fasta&retmode=text" -O coronaEnv.raw.fasta efectc..

0. wild type과 mutant의 전사체 데이터를 비교해 보는 프로젝트를 진행하였다. 따라서, 필요한 데이터는 각 type의 전사체 데이터, annotation 파일 그리고 참조유전체 파일이다.  1. fastq 파일을 bam 파일로 바꾸자. fastq는 header 부분과 quality score 가 들어있는 파일이다. 이제 이 파일을 bam 파일로 바꿔야 된다. 그러기 위해서는 필요한 툴들부터 설치해 보자. (참고로, 이 프로젝트는 구글 코랩에서 진행하였다.) # hisat2와 samtools 설치!apt-get update!apt-get install -y hisat2 samtools위 코드를 실행하고 난 후, # 참조 유전체 경로 설정reference_path = '/content/drive..